PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005601-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family NF-YB
Protein Properties Length: 156aa    MW: 16858 Da    PI: 5.8087
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005601-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB164.61.3e-5124107184
          NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84 
                    vreqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk
  NNU_005601-RA  24 VREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLK 107
                    69********************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.5E-4919111IPR009072Histone-fold
SuperFamilySSF471135.74E-3627114IPR009072Histone-fold
PfamPF008081.6E-283094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.6E-165876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.6E-167795No hitNo description
PRINTSPR006157.6E-1696114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MADAPASPGG GSHESGEQSP RSNVREQDRF LPIANISRIM KKALPANGKI AKDAKETVQE  60
CVSEFISFIT SEASDKCQRE KRKTINGDDL LWAMATLGFE DYIDPLKGDT KGSAKSGDKK  120
DGVGVQQAPN AQMVGLPIHN LNLISMVEDS QSLLNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-4323107185NF-YB
4awl_B2e-4323107286NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4323107286NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010253500.14e-91PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
SwissprotQ8VYK46e-68NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0R0EXD21e-81A0A0R0EXD2_SOYBN; Uncharacterized protein
TrEMBLK7MYY61e-81K7MYY6_SOYBN; Uncharacterized protein
STRINGGLYMA19G36220.24e-81(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.39e-63nuclear factor Y, subunit B8